PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA11G00037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 327aa    MW: 37007.4 Da    PI: 7.6387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA11G00037genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171672148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+ +++ +G+g W+t ++  g         ++R++k+c++rw +yl
       AA11G00037 16 KGPWTPEEDEKLISYIHTHGPGKWRTLPANAGtifirlklrLNRCGKSCRLRWTNYL 72
                     79*****************************************************97 PP

2Myb_DNA-binding52.89.1e-1778122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ +E+e +++++++lG++ W++Ia +++ gRt++++k++w+++
       AA11G00037  78 RGEFSLQEEETIIQLHRLLGNK-WSAIAVHLP-GRTDNEIKNYWNTH 122
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3281172IPR017930Myb domain
SuperFamilySSF466892.06E-2814119IPR009057Homeodomain-like
SMARTSM007171.1E-131574IPR001005SANT/Myb domain
PfamPF002498.9E-161672IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231779IPR009057Homeodomain-like
CDDcd001676.97E-111872No hitNo description
PROSITE profilePS5129424.95873127IPR017930Myb domain
SMARTSM007175.4E-1677125IPR001005SANT/Myb domain
PfamPF002492.8E-1578122IPR001005SANT/Myb domain
CDDcd001671.30E-1180123No hitNo description
Gene3DG3DSA:1.10.10.605.6E-2680127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGKSSTSSSE EGEVKKGPWT PEEDEKLISY IHTHGPGKWR TLPANAGTIF IRLKLRLNRC  60
GKSCRLRWTN YLRPDIKRGE FSLQEEETII QLHRLLGNKW SAIAVHLPGR TDNEIKNYWN  120
THIKKKLLRM GIDPVTHCPR INLLQLSTFL SSPLFKTMLQ PTTSTQFDLT SNVNPEILNN  180
QTESYRFNQP NQNIQTGLTT RFPMEDQLVN NEQISFTGLL NSSVPPVQWQ SKGECFTNST  240
GLSDQSIDNV SLTGNYGTRF VSNDEESFKT GWDFNSSMLH GTMSSSNSTP LNSTPTVYVN  300
GGSEDGRESY GNDLLMFHHR DNTLNLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-27131271105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-271312724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00563DAPTransfer from AT5G54230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759912e-72AF175991.1 Arabidopsis thaliana putative transcription factor (MYB49) mRNA, complete cds.
GenBankAY0598202e-72AY059820.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230; MDK4.5) mRNA, complete cds.
GenBankAY0815122e-72AY081512.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230) mRNA, complete cds.
GenBankAY5196382e-72AY519638.1 Arabidopsis thaliana MYB transcription factor (At5g54230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866031.11e-139hypothetical protein ARALYDRAFT_331771
RefseqXP_002866030.11e-139hypothetical protein ARALYDRAFT_357679
TrEMBLD7MU681e-139D7MU68_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80014661e-139(Arabidopsis lyrata)
STRINGfgenesh1_pm.C_scaffold_80011141e-139(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144651722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G54230.11e-129myb domain protein 49